The domain within your query sequence starts at position 60 and ends at position 191; the E-value for the PSS domain shown below is 7.3e-60.
PHPAYWRFWLCVSVVYELFLIFILFQTVQDGRQFLKYVDPRLGVPLPERDYGGNCLIYDA DNKTDPFHNIWDKLDGFVPAHFIGWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFS ECWWDHWIMDV
PSS |
---|
PFAM accession number: | PF03034 |
---|---|
Interpro abstract (IPR004277): | Phosphatidyl serine synthase is also known as serine exchange enzyme ( EC 2.7.8 ). This family represents eukaryotic PSS I and II, membrane bound proteins that catalyse the replacement of the head group of a phospholipid (phosphotidylcholine or phosphotidylethanolamine) by L-serine. |
GO process: | phosphatidylserine biosynthetic process (GO:0006659) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PSS