The domain within your query sequence starts at position 268 and ends at position 358; the E-value for the PS_Dcarbxylase domain shown below is 2.1e-19.

FPAVGATNVGSIRIHFDRDLHTNSPRYSKGSYNDLSFVTHANKEGIPMRKGEPLGEFNLG
STIVLIFEAPKDFNFRLKAGQKIRFGEALGS

PS_Dcarbxylase

PS_Dcarbxylase
PFAM accession number:PF02666
Interpro abstract (IPR003817):

Phosphatidylserine decarboxylase plays a pivotal role in the synthesis of phospholipid by the mitochondria. The substrate phosphatidylserine is synthesized extramitochondrially and must be translocated to the mitochondria prior to decarboxylation [ (PUBMED:8407984) ]. Phosphatidylserine decarboxylases EC 4.1.1.65 is responsible for conversion of phosphatidylserine to phosphatidylethanolamine and plays a central role in the biosynthesis of aminophospholipids [ (PUBMED:7890740) ].

This family also includes L-tryptophan decarboxylase from the mushroom Psilocybe cubensis, which is required for the biosynthesis of the psychotropic agent psilocybin. This enzyme catalyses the first step in the biosynthetic pathway, converting L-tryptophan to tryptamine [ (PUBMED:28763571) ].

GO process:phospholipid biosynthetic process (GO:0008654)
GO function:phosphatidylserine decarboxylase activity (GO:0004609)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PS_Dcarbxylase