The domain within your query sequence starts at position 35 and ends at position 93; the E-value for the PTB domain shown below is 1.1e-21.
QYHVNHLVTFCLGEEDGVHTVEDASRKLAVMDSQGRVWAQEMLLRVSPSQVTLLDPVSK
PTB |
![]() |
---|
PFAM accession number: | PF08416 |
---|---|
Interpro abstract (IPR013625): | The phosphotyrosine-binding domain (PTB, also phosphotyrosine-interaction or PI domain) of tensin tends to be found at the C terminus. Tensin is a multi-domain protein that binds to actin filaments and functions as a focal-adhesion molecule (focal adhesions are regions of plasma membrane through which cells attach to the extracellular matrix). Human tensin has actin-binding sites, an SH2 ( IPR000980 ) domain and a region similar to the tumour suppressor PTEN [ (PUBMED:11023826) ]. The PTB domain interacts with the cytoplasmic tails of beta integrin by binding to an NPXY motif [ (PUBMED:14592531) ]. The PTB domain is also found in the epidermal growth factor receptor kinase substrate 8 (EPS8). PTB domains have a common PH-like fold and are found in various eukaryotic signaling molecules [ (PUBMED:10610414) ]. This domain was initially shown to binds peptides with a NPXY motif with differing requirements for phosphorylation of the tyrosine, although more recent studies have found that some types of PTB domains can bind to peptides lack tyrosine residues altogether [ (PUBMED:11911882) ]. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine [ (PUBMED:11994738) ]. PTB domains are classified into three groups: phosphotyrosine-dependent Shc-like, phosphotyrosine-dependent IRS-like, and phosphotyrosine-independent Dab-like PTB domains [ (PUBMED:15567406) ]. |
GO function: | protein binding (GO:0005515) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PTB