The domain within your query sequence starts at position 58 and ends at position 197; the E-value for the PTPRCAP domain shown below is 8.1e-51.
SHASGGYYHPARLGAALWGHTCRLLWASPAGRWLRARTELESPEESGPPEDEEDAEDFVI DGGPEEAAAKEEEQRCQAEQTRDPRDTDSDGGLGLSSQGPVGSGSSAEALLSDLHAFSGS AAWDDSAGGAGGQGLRVTAL
PTPRCAP |
![]() |
---|
PFAM accession number: | PF15713 |
---|---|
Interpro abstract (IPR016553): | This group represents protein tyrosine phosphatase receptor type C (PTPRC)-associated protein, also known as CD45-associated protein [ (PUBMED:8537410) (PUBMED:8954783) ]. It is a positive regulator of PTPRC (CD45), which activates Src family kinases implicated in tumorigenesis [ (PUBMED:20019842) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PTPRCAP