The domain within your query sequence starts at position 122 and ends at position 189; the E-value for the PTR2 domain shown below is 4.1e-27.

FKTIIYLSLVYVLGHVFKSLGAIPILGGKMLHTILSLVGLSLIALGTGGIKPCVAAFGGD
QFEEEHGM

PTR2

PTR2
PFAM accession number:PF00854
Interpro abstract (IPR000109):

The proton-dependent oligopeptide transporter (POT) family (also known as the peptide transport (PTR) family) is made up of a group of energy-dependent transporters found in organisms as diverse as bacteria and humans. The POT family of proteins is distinct from the ABC-type peptide transporters and was uncovered by sequence analyses of peptide transport proteins [ (PUBMED:7476181) ]. They seem to be mainly involved in the intake of small peptides [ (PUBMED:7817396) ]. However, some family members are nitrate permeases and others are involved in histidine transport [ (PUBMED:17481610) ].

GO process:transmembrane transport (GO:0055085)
GO component:membrane (GO:0016020)
GO function:transmembrane transporter activity (GO:0022857)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PTR2