The domain within your query sequence starts at position 52 and ends at position 294; the E-value for the PTRF_SDPR domain shown below is 3.8e-96.
QVNAVTVHTLLDKLVNMLDAVRENQHNMEQRQINLEGSVKGIQNDLTKLSKYQASTSNTV SKLLEKSRKVSAHTRAVRERLERQCVQVKRLENNHAQLLRRNHFKVLIFQEESEIPASVF VKEPVPSAAEGKEELADENKSLEETLHNVDLSSDDELPRDEEALEDSAEEKMEESRAEKI KRSSLKKVDSLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTPNHQKASSGKSSPFK VSP
PTRF_SDPR |
---|
PFAM accession number: | PF15237 |
---|---|
Interpro abstract (IPR026752): | This entry represents the cavin family (caveolae-associated proteins; previously known as the PTRF/SDPR family), which includes proteins cavin-1 to 4. They are critical regulators for caveolae dynamics [ (PUBMED:20363285) ]. Caveolae are invaginations of the plasma membrane involved in many cellular processes, including clathrin-independent endocytosis, cholesterol transport, and signal transduction. Caveolins are the principal components of caveolae membranes. Polymerase I and transcript release factor (PTRF; also known as cavin-1) is essential for formation of caveolae and proper localisation of caveolins [ (PUBMED:19726876) ]. Cavin-2 (also known as serum deprivation-response protein) may play a role in targeting protein kinase C alpha (PKCalpha) to caveolae [ (PUBMED:9566962) ]. Cavin-3 (protein kinase C delta-binding protein, also known as SRBC) seems to have an immune potentiation function, especially in the glioma [ (PUBMED:9054438) (PUBMED:15197346) ]. Cavin-4 (muscle-related coiled-coil protein) is a muscle-restricted cavin [ (PUBMED:18332105) ]. The members of the cavin family contain putative leucine zipper-like domains normally involved in protein-protein interactions and PEST domains (proline, glutamic acid, serine and threonine-rich domains), which may play a role in targeting proteins towards proteolytic degradation [ (PUBMED:15242332) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PTRF_SDPR