The domain within your query sequence starts at position 68 and ends at position 148; the E-value for the PUB domain shown below is 7.1e-17.
LNTLSTALNILEKYGRNLLSPQRPRYWRSVKFNNPVFRSTVDAVQGGRDVLRLYGYTEER PDGLSFPEGQEEPDEYQVAVV
PUB |
![]() |
---|
PFAM accession number: | PF09409 |
---|---|
Interpro abstract (IPR018997): | The PUB (also known as PUG) domain is found in peptide N-glycanase where it functions as a AAA ATPase binding domain [ (PUBMED:16807242) ]. This domain is also found on other proteins linked to the ubiquitin-proteasome system. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PUB