The domain within your query sequence starts at position 54 and ends at position 237; the E-value for the ParcG domain shown below is 6.5e-87.
TTFRKCYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLSEMTFPYEFFARR GIHDMLEHGGNKILPVIPQLIIPIKNALNLRNRQIICVTLKVLQHLVVSSEMVGEALLPY YRQILPILNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGEDAFINIKYMVP TYES
ParcG |
---|
PFAM accession number: | PF10274 |
---|---|
Interpro abstract (IPR019399): | This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter. The protein has predicted alpha-helical and beta-sheet domains which suggest its function is in the ubiquitin/proteasome system [ (PUBMED:12547187) ]. Mutations in parkin are the genetic cause of early-onset and autosomal recessive juvenile parkinsonism. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ParcG