SMART: Pfam domain Pcc1

The domain within your query sequence starts at position 170 and ends at position 228; the E-value for the Pcc1 domain shown below is 1.1e-9.

VDYVQVDEQKTQALRSTKQEWTDERQSKVRWTTEDPVLFRISINNFLDQLSLVMRNIQH

Pcc1

PFAM accession number:	PF09341
Interpro abstract (IPR015419):	This entry represents the CTAG/Pcc1 family. Its members include yeast EKC/KEOPS complex subunit Pcc1, mammalian EKC/KEOPS complex subunit Lage3 and human cancer/testis antigen (CTAG) 1/2. In Saccharomyces cerevisiae, Pcc1 is a component of the EKC/KEOPS protein complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine [ (PUBMED:16874308) ]. Similar to its S. cerevisiae homologue, human Lage3 is part of the EKC complex that is essential for a universal tRNA modification. The human EKC complex interacts with tumour antigen PRAME (preferentially expressed antigen in melanoma), and hence involved in oncogenesis [ (PUBMED:22912744) ]. Human CTAG 1 and 2 (also known as NY-ESO-1 and 2) share protein sequence similarity with Pcc1, however, their function is not clear. They are linked to cancer progression [ (PUBMED:24970819) ].

PFAM accession number:

PF09341

Interpro abstract (IPR015419):

This entry represents the CTAG/Pcc1 family. Its members include yeast EKC/KEOPS complex subunit Pcc1, mammalian EKC/KEOPS complex subunit Lage3 and human cancer/testis antigen (CTAG) 1/2.

In Saccharomyces cerevisiae, Pcc1 is a component of the EKC/KEOPS protein complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t6A37) in tRNAs that read codons beginning with adenine [ (PUBMED:16874308) ].

Similar to its S. cerevisiae homologue, human Lage3 is part of the EKC complex that is essential for a universal tRNA modification. The human EKC complex interacts with tumour antigen PRAME (preferentially expressed antigen in melanoma), and hence involved in oncogenesis [ (PUBMED:22912744) ].

Human CTAG 1 and 2 (also known as NY-ESO-1 and 2) share protein sequence similarity with Pcc1, however, their function is not clear. They are linked to cancer progression [ (PUBMED:24970819) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pcc1