The domain within your query sequence starts at position 59 and ends at position 189; the E-value for the Pep_M12B_propep domain shown below is 4e-12.
ASPLPREEEIVFPEKLNGSSILPGSGVPARLLYRLPAFGEMLLLELEQDPGVQVEGLTVQ YLGQAPEMLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGAL NSAGGPGAHIL
Pep_M12B_propep |
---|
PFAM accession number: | PF01562 |
---|---|
Interpro abstract (IPR002870): | This signature covers the region of the propeptide for members of the MEROPS peptidase family M12B (clan MA(M), adamalysin family). The propeptide contains a sequence motif similar to the "cysteine switch" of the matrixins, which mediate cell-cell or cell-matrix interactions. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pep_M12B_propep