The domain within your query sequence starts at position 1 and ends at position 230; the E-value for the Peptidase_C65 domain shown below is 2.9e-75.
MSETSFNLISEKCDILSILRDHPENRIYQRKIQELSKRFTSIRKTKGDGNCFYRALGYSY LESLLGKSREILKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDSSVSSLLK VFNDQSSSDRIVQFLRLLTSAFIRNRADFFRHFIDEEMDIKDFCTHEVEPMAMECDHVQI TALSQALNIALQVEYVDEMDTALNHHVFPEAAIPSVYLLYKTSHYNILYA
Peptidase_C65 |
![]() |
---|
PFAM accession number: | PF10275 |
---|---|
Interpro abstract (IPR019400): | This family of proteins is a highly specific ubiquitin iso-peptidase that removes ubiquitin from proteins [ (PUBMED:12704427) ]. The modification of cellular proteins by ubiquitin (Ub) is an important event that underlies protein stability and function in eukaryotes, as it is a dynamic and reversible process. Otubain carries several key conserved domains: (i) the OTU (ovarian tumour domain) in which there is an active cysteine protease triad (ii) a nuclear localisation signal, (iii) a Ub interaction motif (UIM)-like motif phi-xx-A-xxxs-xx-Ac (where phi indicates an aromatic amino acid, x indicates any amino acid and Ac indicates an acidic amino acid), (iv) a Ub-associated (UBA)-like domain and (v) the LxxLL motif [ (PUBMED:1270442) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_C65