The domain within your query sequence starts at position 22 and ends at position 57; the E-value for the Peptidase_M18 domain shown below is 1.3e-9.
FVNRSPSPFHVVAECRSRLLQAGFRELKETEGWDI
Peptidase_M18 |
![]() |
---|
PFAM accession number: | PF02127 |
---|---|
Interpro abstract (IPR001948): | This group of metallopeptidases belong to the MEROPS peptidase family M18, (clan MH). The proteins have two catalytic zinc ions at the active site, bound by His/Asp, Asp, Glu, Asp/Glu and His. The catalysed reaction involves the release of an N-terminal aminoacid, usually neutral or hydrophobic, from a polypeptide [ (PUBMED:7674922) ]. The type example is aminopeptidase I from Saccharomyces cerevisiae (Baker's yeast), the sequence of which has been deduced, and the mature protein shown to consist of 469 amino acids [ (PUBMED:2651436) ]. A 45-residue presequence contains both positively- and negatively-charged and hydrophobic residues, which could be arranged in an N-terminal amphiphilic alpha-helix [ (PUBMED:2651436) ]. The presequence differs from signal sequences that direct proteins across bacterial plasma membranes and endoplasmic reticulum or into mitochondria. It is unclear how this unique presequence targets aminopeptidase I to yeast vacuoles, and how this sorting utilises classical protein secretory pathways [ (PUBMED:2651436) ]. |
GO process: | proteolysis (GO:0006508) |
GO function: | aminopeptidase activity (GO:0004177), zinc ion binding (GO:0008270) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_M18