The domain within your query sequence starts at position 555 and ends at position 619; the E-value for the Peptidase_M24_C domain shown below is 7.3e-26.
GSLTFEPLTLVPIQTKMIDVNALTDKECDWLNSYHQTCRDVVGKELQSQGRQEALEWLIR ETEPV
Peptidase_M24_C |
 |
|---|
| PFAM accession number: | PF16188 |
|---|---|
| Interpro abstract (IPR032416): | This is a short region at the C terminus of a number of metallo-peptidases of the M24 family. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_M24_C