The domain within your query sequence starts at position 51 and ends at position 123; the E-value for the Peptidase_S24 domain shown below is 8.5e-12.
VVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQDGHIK FLTKGDNNAVDDR
Peptidase_S24 |
![]() |
---|
PFAM accession number: | PF00717 |
---|---|
Interpro abstract (IPR015927): | This entry represents a stuctural domain superfamily found in serine peptidases belonging to MEROPS peptidase families: S24 (LexA family, clan SF); S26A (signal peptidase I), S26B (signalase) and S26C TraF peptidase. This domain has a complex fold made of several coiled beta-sheets, which contains an SH3-like barrel structure. The S26 family includes Escherichia coli signal peptidase, SPase, which is a membrane-bound endopeptidase with two N-terminal transmembrane segments and a C-terminal catalytic region [ (PUBMED:9823901) ]. SPase functions to release proteins that have been translocated into the inner membrane from the cell interior, by cleaving off their signal peptides. In SPase proteins, this domain is disrupted by the insertion of an additional all-beta subdomain.
The S24 family includes:
All of these proteins, with the possible exception of RulA, interact with RecA, which activates self cleavage either derepressing transcription in the case of CI and LexA [ (PUBMED:10692372) ] or activating the lesion-bypass polymerase in the case of UmuD and MucA. UmuD'2, is the homodimeric component of DNA pol V, which is produced from UmuD by RecA-facilitated self-cleavage. The first 24 N-terminal residues of UmuD are removed; UmuD'2 is a DNA lesion bypass polymerase [ (PUBMED:10692372) (PUBMED:11483531) ]. MucA [ (PUBMED:9925794) (PUBMED:11016960) ], like UmuD, is a plasmid encoded a DNA polymerase (pol RI) which is converted into the active lesion-bypass polymerase by a self-cleavage reaction involving RecA [ (PUBMED:11114935) ]. This group of proteins also contains proteins not recognised as peptidases as well as those classified as non-peptidase homologues as they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for catalytic activity. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Peptidase_S24