The domain within your query sequence starts at position 26 and ends at position 225; the E-value for the Pex2_Pex12 domain shown below is 3.7e-39.
NKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFLWLFLWRFTIYSKNATVGQSVLNIQY KNDSSLNLIYQPPSKTQKLWYAVCTIGGKWLEERCYDLFRNRHLASFGKAKQFMNFLVGL LKLGELINFLIFLQKGKFATLTERLLGIHSVFCKPQNMREVGFEYMNRELLWHGFAEFLI FLLPLINIQKLKAKLSSWCI
Pex2_Pex12 |
---|
PFAM accession number: | PF04757 |
---|---|
Interpro abstract (IPR006845): | This region is the N-terminal part of a number of peroxisomal biogenesis proteins, including Pex2, Pex10 and Pex12, which contain two predicted transmembrane segments. The majority of these proteins have a C-terminal ring finger domain IPR001841 . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pex2_Pex12