SMART: Pfam domain PfkB

The domain within your query sequence starts at position 3 and ends at position 113; the E-value for the PfkB domain shown below is 4.2e-15.

EKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASNSCTVLSLLGARCAFMGS
LAPGHVADFVLDDLRQHSVDLRYVVLQTEGSIPTSTVIINEASGSRTILHA

PfkB

PFAM accession number:	PF00294
Interpro abstract (IPR011611):	This domain is found in a variety of carbohydrate and pyrimidine kinases. It is found in phosphomethylpyrimidine kinase ( EC 2.7.4.7 ), which is part of the thiamine pyrophosphate (TPP) synthesis pathway - TPP being an essential cofactor for many enzymes [ (PUBMED:9519409) ]. It is also found in 2-keto-3-deoxygluconate kinase, which is a component of the Entner-Doudoroff pathway in hyperthermophilic archaea [ (PUBMED:15869466) ].

PFAM accession number:

PF00294

Interpro abstract (IPR011611):

This domain is found in a variety of carbohydrate and pyrimidine kinases. It is found in phosphomethylpyrimidine kinase ( EC 2.7.4.7 ), which is part of the thiamine pyrophosphate (TPP) synthesis pathway - TPP being an essential cofactor for many enzymes [ (PUBMED:9519409) ]. It is also found in 2-keto-3-deoxygluconate kinase, which is a component of the Entner-Doudoroff pathway in hyperthermophilic archaea [ (PUBMED:15869466) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PfkB