The domain within your query sequence starts at position 3 and ends at position 113; the E-value for the PfkB domain shown below is 4.2e-15.
EKQILCVGLVVLDIINVVDKYPEEDTDRRCLSQRWQRGGNASNSCTVLSLLGARCAFMGS LAPGHVADFVLDDLRQHSVDLRYVVLQTEGSIPTSTVIINEASGSRTILHA
PfkB |
![]() |
---|
PFAM accession number: | PF00294 |
---|---|
Interpro abstract (IPR011611): | This domain is found in a variety of carbohydrate and pyrimidine kinases. It is found in phosphomethylpyrimidine kinase ( EC 2.7.4.7 ), which is part of the thiamine pyrophosphate (TPP) synthesis pathway - TPP being an essential cofactor for many enzymes [ (PUBMED:9519409) ]. It is also found in 2-keto-3-deoxygluconate kinase, which is a component of the Entner-Doudoroff pathway in hyperthermophilic archaea [ (PUBMED:15869466) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PfkB