The domain within your query sequence starts at position 16 and ends at position 74; the E-value for the Phe_ZIP domain shown below is 1.5e-30.

PDWRQFCELHAQVAAVDFAHKFCRFLRDNPTYDTPDAGTSFSRHFAANFLAVFSEEVRR

Phe_ZIP

 Phe_ZIP
PFAM accession number:PF08916
Interpro abstract (IPR015012):

The phenylalanine zipper consists of aromatic side chains from ten phenylalanine residues that are stacked within a hydrophobic core. This zipper mediates dimerisation of various proteins, such as APS, SH2-B and Lnk [ (PUBMED:15378031) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Phe_ZIP