The domain within your query sequence starts at position 22 and ends at position 77; the E-value for the Phe_ZIP domain shown below is 2e-22.
RGWSDFCEQHAAAAARELARQYWLFARAHPQPPRADLVSLQFAELFQRHFCREVRE
Phe_ZIP |
![]() |
---|
PFAM accession number: | PF08916 |
---|---|
Interpro abstract (IPR015012): | The phenylalanine zipper consists of aromatic side chains from ten phenylalanine residues that are stacked within a hydrophobic core. This zipper mediates dimerisation of various proteins, such as APS, SH2-B and Lnk [ (PUBMED:15378031) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Phe_ZIP