The domain within your query sequence starts at position 51 and ends at position 106; the E-value for the PhoLip_ATPase_N domain shown below is 9.6e-22.

TIFINQPQLTKFCNNHVSTAKYNVITFLPRFLYSQFRRAANSFFLFIALLQQIPDV

PhoLip_ATPase_N

PhoLip_ATPase_N
PFAM accession number:PF16209
Interpro abstract (IPR032631):

This domain is found at the N terminus of a number of phospholipid-translocating ATPases. It is found in eukaryotes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PhoLip_ATPase_N