The domain within your query sequence starts at position 25 and ends at position 287; the E-value for the Phosphodiest domain shown below is 5.2e-8.
VLLIVADDGGFESGVYNNTAIATPHLDALSRHSLIFRNAFTSVSSCSPSRASLLTGLPQH QNGMYGLHQDVHHFNSFDKVQSLPLLLNQAGVRTGIIGKKHVGPETVYPFDFAFTEENSS VMQVGRNITRIKQLVQKFLQTQDDRPFFLYVAFHDPHRCGHSQPQYGTFCEKFGNGESGM GYIPDWTPQIYDPQDVMVPYFVPDTPAARADLAAQYTTIGRMDQGVGLVLQELRGAGVLN DTLIIFTSDNGIPFPSGRTNLYW
Phosphodiest |
---|
PFAM accession number: | PF01663 |
---|---|
Interpro abstract (IPR002591): | This family consists of phosphodiesterases, including human plasma-cell membrane glycoprotein PC-1 / alkaline phosphodiesterase I / nucleotide pyrophosphatase (nppase). These enzymes catalyse the cleavage of phosphodiester and phosphosulphate bonds in NAD, deoxynucleotides and nucleotide sugars [ (PUBMED:9344668) ]. Another member of this family is ATX an autotaxin, tumor cell motility-stimulating protein which exhibits type I phosphodiesterases activity [ (PUBMED:7982964) ]. The alignment encompasses the active site [ (PUBMED:7730366) (PUBMED:7982964) ]. Also present within this family is 60kDa Ca 2+ -ATPase from Myroides odoratus [ (PUBMED:8617788) ]. This signature also hits a number of ethanolamine phosphate transferase involved in glycosylphosphatidylinositol-anchor biosynthesis. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Phosphodiest