The domain within your query sequence starts at position 417 and ends at position 541; the E-value for the Phostensin domain shown below is 7.7e-49.
APTAPQPSGDPLMSRLFYGVKPGPGVGAPRRSGHTFTVNPRRCAPPASPAPPVNPATADA AGSGSGKKRYPTAEEILVLGGYLRLSRSCLVKGSPERHHKQLKISFSETALETTYQYPSE SSVLE
Phostensin |
![]() |
---|
PFAM accession number: | PF13914 |
---|---|
Interpro abstract (IPR025907): | Phostensin has been identified as a PP1 regulatory protein, binding PP1 at the KISF motif found in this domain. This domain also appears to carry an incomplete SH3-binding domain PxRxP further upstream. It is likely that phostensin targets PP1 to the F-actin cytoskeleton [ (PUBMED:17374523) ]. Phostensin binds to actin and decreases the elongation and depolymerisation rates of actin filament pointed ends [ (PUBMED:19622346) ]. This domain is also found in the taperin, which is a PP1 binding protein that is ancestrally related to phostensin. Taperin has a role in sound perception [ (PUBMED:20170899) ]. |
GO function: | phosphatase binding (GO:0019902) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Phostensin