The domain within your query sequence starts at position 8 and ends at position 89; the E-value for the Phostensin_N domain shown below is 8.3e-38.
DPGPRTVMPAWKREILERRRAKLAALSGGQGSGAAPDGPNERLVLAESLGPLSQNPFMRL ESERRRGTRPAQQLLELYCRVP
Phostensin_N |
---|
PFAM accession number: | PF13916 |
---|---|
Interpro abstract (IPR025903): | Phostensin has been identified as a PP1 regulatory protein binding protein. This domain is N-terminal to the PP1- and SH3-binding regions, though may carry an additional SH3-binding motif. It is likely that phostensin targets PP1 to the F-actin cytoskeleton [ (PUBMED:17374523) ]. Phostensin binds to actin and decreases the elongation and depolymerisation rates of actin filament pointed ends [ (PUBMED:19622346) ]. This domain is also found in the taperin, which is a PP1 binding protein that is ancestrally related to phostensin. Taperin has a role in sound perception [ (PUBMED:20170899) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Phostensin_N