The domain within your query sequence starts at position 195 and ends at position 451; the E-value for the Pkinase_Tyr domain shown below is 4.7e-42.

LKFDIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLTKLERQRFKEEAEMLKGLQHPNI
VRFYDFWESSAKGKRCIVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLLFLHT
RTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEHYD
ESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTCGIKPASFEKVHDPEIKEIIGECI
CKNKEERYEIKDLLSHA

Pkinase_Tyr

Pkinase_Tyr
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pkinase_Tyr