SMART: Pfam domain Plug

The domain within your query sequence starts at position 40 and ends at position 74; the E-value for the Plug_translocon domain shown below is 4e-22.

FIFLVCCQIPLFGIMSSDSADPFYWMRVILASNRG

Plug_translocon

PFAM accession number:	PF10559
Interpro abstract (IPR019561):	The Sec61/SecY translocon mediates translocation of proteins across the membrane and integration of membrane proteins into the lipid bilayer. The structure of the translocon revealed a plug domain blocking the pore on the lumenal side. The plug is unlikely to be important for sealing the translocation pore in yeast but it plays a role in stabilising Sec61p during translocon formation. The domain runs from residues 52-74 [ (PUBMED:16822836) ].

PFAM accession number:

PF10559

Interpro abstract (IPR019561):

The Sec61/SecY translocon mediates translocation of proteins across the membrane and integration of membrane proteins into the lipid bilayer. The structure of the translocon revealed a plug domain blocking the pore on the lumenal side. The plug is unlikely to be important for sealing the translocation pore in yeast but it plays a role in stabilising Sec61p during translocon formation. The domain runs from residues 52-74 [ (PUBMED:16822836) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Plug_translocon