The domain within your query sequence starts at position 215 and ends at position 271; the E-value for the PolyA_pol_RNAbd domain shown below is 1.4e-14.

HDHETLEAIAENAKGLAGISGERIWVELKKILTGDHVNHLIHLIYDLGVAPHIGLPA

PolyA_pol_RNAbd

• PFAM accession number: PF12627
• Interpro abstract (IPR032828):

  This region encompasses much of the RNA and SrmB binding motifs on polymerase A [ (PUBMED:10361280) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PolyA_pol_RNAbd