The domain within your query sequence starts at position 26 and ends at position 95; the E-value for the Porin_3 domain shown below is 9e-16.

NPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHFQVAHTVHMSALGLPGYHLHTAYAGD
WQLSPTETQQ

Porin_3

Porin_3
PFAM accession number:PF01459
Interpro abstract (IPR027246):

This entry represents both eukaryotic mitochondrial porins and Tom40 proteins.

Eukaryotic mitochondrial porins are voltage-dependent anion-selective channels (VDAC) that behave as general diffusion pores for small hydrophilic molecules [ (PUBMED:8031826) (PUBMED:1384178) (PUBMED:1689252) (PUBMED:2442148) ]. The channels adopt an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The eukaryotic mitochondrial porins are beta-barrel proteins, composed of between 12 to 16 beta-strands that span the mitochondrial outer membrane. Yeast contains two members of this family (genes POR1 and POR2); vertebrates have at least three members (genes VDAC1, VDAC2 and VDAC3) [ (PUBMED:8812436) ]. They are related to the mitochondrial import receptor subunit Tom40 proteins, sharing a common evolutionary origin and structure [ (PUBMED:22178864) ].

Tom40 is a mitochondrion outer membrane protein and a component of the TOM (translocator of the outer mitochondrial membrane) complex, which is essential for import of protein precursors into mitochondria [ (PUBMED:10427088) ]. In Saccharomyces cerevisiae, TOM complex is composed of the subunits Tom70, Tom40, Tom22, Tom20, Tom7, Tom6, and Tom5 [ (PUBMED:1327874) (PUBMED:9774667) ]. Tom40 is an integral membrane protein and the main structural component of the protein-conducting channel formed by the TOM complex [ (PUBMED:14595396) ]. It is stabilised by other components, such as Tom5, Tom6, and Tom7 [ (PUBMED:11866524) ].

GO process:transmembrane transport (GO:0055085)
GO component:mitochondrial outer membrane (GO:0005741)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Porin_3