The domain within your query sequence starts at position 43 and ends at position 141; the E-value for the Prefoldin_3 domain shown below is 5.2e-12.
QEKIQHWEKVDNDYSALQERLRTLPDKLSYDVMVPFGPLAFMPGKLVHTNEVTVLLGDNW FAKCSAKQAVGLVEHRKEHVRKTIDDFKKVLKNFESRVE
Prefoldin_3 |
 |
|---|
| PFAM accession number: | PF13758 |
|---|---|
| Interpro abstract (IPR039553): | This family includes prefoldin subunits that are not detected by IPR004127 . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Prefoldin_3