The domain within your query sequence starts at position 32 and ends at position 149; the E-value for the Prenyltransf domain shown below is 5.2e-42.
IMDGNRRYAKKCQVERQEGHTQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVD GLLDLARQKFSCLMEEQEKLQKHGVCIRVLGDLHLLPLDLQEKIAHAIQATKNYNNDV
Prenyltransf |
---|
PFAM accession number: | PF01255 |
---|---|
Interpro abstract (IPR001441): | In prokaryotes, undecaprenyl diphosphate synthase (UPP synthase, di-trans-poly-cis-decaprenylcistransferase or ditrans,polycis-undecaprenyl-diphosphate synthase ( EC 2.5.1.31 )), catalyzes the formation of the carrier lipid undecaprenyl pyrophosphate (UPP) in bacterial cell wall peptidoglycan biosynthesis from isopentenyl pyrophosphate (IPP) [ (PUBMED:9882662) (PUBMED:9677368) (PUBMED:16900467) (PUBMED:23134568) (PUBMED:12636086) (PUBMED:22471620) (PUBMED:11076526) (PUBMED:11346651) (PUBMED:10908715) (PUBMED:10586494) (PUBMED:1181565) (PUBMED:11442630) (PUBMED:12135472) (PUBMED:10816587) ]. Cis (Z)-Isoprenyl diphosphate synthase (cis-IPPS) catalyzes the successive 1'-4 condensation of the IPP molecule to trans,trans-farnesyl diphosphate (FPP) or to cis,trans-FPP to form long-chain polyprenyl diphosphates. A few can also catalyze the condensation of IPP to trans-geranyl diphosphate to form the short-chain cis,trans- FPP. cis-IPPS form homodimers and are mechanistically and structurally distinct from trans-IPPS, which lack the DDXXD motifs, yet require Mg 2+ for activity. Homologues are also found in archaebacteria and include a number of uncharacterised proteins including some from yeasts. This entry also matches related enzymes that transfer alkyl groups, such as dehydrodolichyl diphosphate synthase from eukaryotes, which catalyzes the formation of the polyisoprenoid glycosyl carrier lipid dolichyl monophosphate. |
GO function: | transferase activity, transferring alkyl or aryl (other than methyl) groups (GO:0016765) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Prenyltransf