The domain within your query sequence starts at position 73 and ends at position 141; the E-value for the Preseq_ALAS domain shown below is 2.8e-12.

AAVQQAPDESQMAQTPDGTQLPSGHPSPATSQGSGSKCPFLAAQLSQTGSSVFRKASLEL
QEDVQEMHA

Preseq_ALAS

Preseq_ALAS
PFAM accession number:PF09029
Interpro abstract (IPR015118):

The N-terminal presequence domain found in 5-aminolevulinate synthase exists as an amphipathic helix, with a positively charged surface provided by lysine residues and no stable helix at the N terminus. The domain is essential for the import process by which ALAS is transported into the mitochondria: translocase of the outer membrane (Tom) and translocase of the inner membrane protein complexes appear responsible for recognition and import through the mitochondrial membrane. The protein Tom20 is anchored to the mitochondrial outer membrane, and its interaction with presequences is thought to be the recognition step which allows subsequent import [ (PUBMED:11566198) ].

GO process:porphyrin-containing compound metabolic process (GO:0006778)
GO component:mitochondrial matrix (GO:0005759)
GO function:5-aminolevulinate synthase activity (GO:0003870), pyridoxal phosphate binding (GO:0030170)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Preseq_ALAS