The domain within your query sequence starts at position 139 and ends at position 261; the E-value for the Pribosyltran domain shown below is 1.5e-15.
DIPVDNLYAEPAVLKWIKENISDWRNCTIVSPDAGGAKRVTSIADHLNVDFALIHKERKK ANEVDRMVLVGDVKDRVAILVDDMADTCGTICYAADKLLSEGATRVYAILTHGIFSGPAI ARI
Pribosyltran |
---|
PFAM accession number: | PF00156 |
---|---|
Interpro abstract (IPR000836): | This entry refers to the phosphoribosyl transferase (PRT) type I domain. PRTases catalyze the displacement of the alpha-1'-pyrophosphate of 5-phosphoribosyl-alpha1-pyrpphosphate (PRPP) by a nitrogen-containing nucleophile. The reaction products are an alpha-1 substituted ribose-5'-phosphate and a free pyrophosphate (PP). PRPP, an activated form of ribose-5-phosphate, is a key metabolite connecting nucleotide synthesis and salvage pathways. The type I PRTases are identified by a conserved PRPP binding motif which features two adjacent acidic residues surrounded by one or more hydrophobic residue. This domain is found in a range of diverse phosphoribosyl transferase enzymes and regulatory proteins of the nucleotide synthesis and salvage pathways, including adenine phosphoribosyltransferase EC 2.4.2.7 hypoxanthine-guanine-xanthine phosphoribosyltransferase, hypoxanthine phosphoribosyltransferase EC 2.4.2.8 ribose-phosphate pyrophosphokinase EC 2.7.6.1 amidophosphoribosyltransferase EC 2.4.2.14 orotate phosphoribosyltransferase EC 2.4.2.10 uracil phosphoribosyltransferase EC 2.4.2.9 and xanthine-guanine phosphoribosyltransferase EC 2.4.2.22 . In Arabidopsis, at the very N terminus of this domain is the P-Loop NTPase domain [ (PUBMED:17143579) (PUBMED:11751055) (PUBMED:18550080) (PUBMED:15689504) (PUBMED:18399692) (PUBMED:12808089) (PUBMED:8894695) (PUBMED:22075667) (PUBMED:15096496) (PUBMED:7030616) (PUBMED:6105839) (PUBMED:21366534) (PUBMED:18535147) ]. |
GO process: | nucleoside metabolic process (GO:0009116) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pribosyltran