The domain within your query sequence starts at position 82 and ends at position 165; the E-value for the Pro-MCH domain shown below is 1.5e-50.
SKNTGSKQNLVTHGLPLSLAVKPYLALKGSVAFPAENGVQNAESTQEKREIGDEENSAKF PIGRRDFDMLRCMLGRVYRPCWQV
Pro-MCH |
 |
|---|
| PFAM accession number: | PF05824 |
|---|---|
| Interpro abstract (IPR005456): | Melanin-concentrating hormone (MCH) is a cyclic peptide originally identified in teleost fish [ (PUBMED:10421367) (PUBMED:10421368) ]. In fish, MCH is released from the pituitary and causes lightening of skin pigment cells through pigment aggregation [ (PUBMED:10996523) ]. In mammals, MCH is predominantly expressed in the hypothalamus, and functions as a neurotransmitter in the control of a range of functions. A major role of MCH is thought to be in the regulation of feeding: injection of MCH into rat brains stimulates feeding; expression of MCH is upregulated in the hypothalamus of obese and fasting mice; and mice lacking MCH are lean and eat less [ (PUBMED:10421367) ]. MCH and alpha melanocyte-stimulating hormone (alpha-MSH) have antagonistic effects on a number of physiological functions. Alpha-MSH darkens pigmentation in fish and reduces feeding in mammals, whereas MCH increases feeding [ (PUBMED:10996523) ]. MCH is derived from a pre-pro-hormone (pre-pro-MCH), which contains 1-2 hormones other than MCH, depending on the species. In all species, the 17-19 C-terminal amino acids are cleaved to release MCH. In mammals, amino acids 132-144 encode the hormone neuropeptide EI (NEI), whilst in salmonids, the analogous region encodes neuropeptide EV (NEV), and in other fish, the region determines MCH gene-related peptide (Mgrp) [ (PUBMED:8559281) ]. A further peptide, known as neuropeptide GE (NGE), is thought to be found in mammalian pre-pro-MCH upstream of NEI, encoded by amino acids 110-129. NEI has been shown to enhance oxytocin and reduce arginine vasopressin secretion from rat pituitary [ (PUBMED:9175893) ]. Two paralogues of MCH, known as pro-MCH-like 1 and 2 genes (PMCHL1 and PMCHL2), which arose recently in primate evolution, also exist. At present, it is unclear whether the PMCHL genes are functional genes or inactive pseudogenes. |
| GO process: | chemical synaptic transmission (GO:0007268) |
| GO function: | melanin-concentrating hormone activity (GO:0030354) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pro-MCH