The domain within your query sequence starts at position 26 and ends at position 65; the E-value for the Propeptide_C1 domain shown below is 5.4e-22.
LSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGG
Propeptide_C1 |
 |
|---|
| PFAM accession number: | PF08127 |
|---|---|
| Interpro abstract (IPR012599): | This domain is found at the N-terminal of cathepsin B and cathepsin B-like peptidases that belong to MEROPS peptidase subfamily C1A. Cathepsin B are lysosomal cysteine proteinases belonging to the papain superfamily and are unique in their ability to act as both an endo- and an exopeptidases. They are synthesized as inactive zymogens. Activation of the peptidases occurs with the removal of the propeptide [ (PUBMED:7890671) (PUBMED:8740363) ]. |
| GO process: | regulation of catalytic activity (GO:0050790) |
| GO function: | cysteine-type endopeptidase activity (GO:0004197) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Propeptide_C1