The domain within your query sequence starts at position 330 and ends at position 459; the E-value for the Prp31_C domain shown below is 4.1e-50.

PVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFS
LGHLGKSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFT
PLQGLEIVNP

Prp31_C

Prp31_C
PFAM accession number:PF09785
Interpro abstract (IPR019175):

This is the C-terminal domain of the pre-mRNA processing factor Prp31. Prp31 is required for U4/U6*U5 tri-snRNP formation [ (PUBMED:11867543) ]. In humans this protein has been linked to autosomal dominant retinitis pigmentosa [ (PUBMED:11867543) (PUBMED:12444105) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Prp31_C