The domain within your query sequence starts at position 39 and ends at position 132; the E-value for the Pterin_4a domain shown below is 1.5e-33.
QWLTAEERDQLIPGLKAAGWSELSERDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPE WFNVYNKVQITLTSHDCGGLTKRDVKLAQFIEKA
Pterin_4a |
---|
PFAM accession number: | PF01329 |
---|---|
Interpro abstract (IPR001533): | Pterin 4 alpha carbinolamine dehydratase is also known as DCoH. DCoH is the dimerisation cofactor of hepatocyte nuclear factor 1 (HNF-1) that functions as both a transcriptional coactivator and a pterin dehydratase [ (PUBMED:8897596) ]. X-ray crystallographic studies have shown that the ligand binds at four sites per tetrameric enzyme, with little apparent conformational change in the protein. |
GO process: | tetrahydrobiopterin biosynthetic process (GO:0006729) |
GO function: | 4-alpha-hydroxytetrahydrobiopterin dehydratase activity (GO:0008124) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pterin_4a