The domain within your query sequence starts at position 3 and ends at position 239; the E-value for the Put_Phosphatase domain shown below is 9.3e-99.

VLLVFDFDNTIIDDNSDTWIVQCAPDKKLPIELQDSYQKGLWTEFMGRVFKYLRDEGVKA
DELKRAVTSLPFTSGMIELLSFLRMNKDRFDCIIISDSNSIFIDWVLEAAAFHDVFDHVF
TNPASFDSSGRLTVKNYHAHSCTRCPKNLCKNTVLGEFIDKQLQKGVRYTRIVYIGDGGN
DVCPVTFLKKNDVAMPREGYTLHRTLAKMSQNLEPMESSIVVWSSGVEIISHLQFLI

Put_Phosphatase

Put_Phosphatase
PFAM accession number:PF06888
Interpro abstract (IPR016965):

This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [ (PUBMED:14983068) ]. It includes plant phosphatases with homology to the haloacid dehalogenase (HAD) superfamily [ (PUBMED:21122813) (PUBMED:11161030) ]. PHOSPHO1 is a phosphoethanolamine/phosphocholine phosphatase [ (PUBMED:15175005) ], while PHOSPHO2 has high activity toward pyridoxal 5'-phosphate (PLP), and it is active at much lower level toward pyrophosphate, phosphoethanolamine (PEA)and phosphocholine (PCho) [ (PUBMED:16054448) ].

GO function:phosphatase activity (GO:0016791)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Put_Phosphatase