The domain within your query sequence starts at position 192 and ends at position 273; the E-value for the Pyr_redox domain shown below is 1.3e-18.
KTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQF VPTKIEQIEAGTPGRLRVTAQS
Pyr_redox |
![]() |
---|
PFAM accession number: | PF00070 |
---|---|
Interpro abstract (IPR039648): | Proteins containing this domain include both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain [ (PUBMED:8805537) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pyr_redox