The domain within your query sequence starts at position 309 and ends at position 386; the E-value for the Pyr_redox domain shown below is 9.6e-16.

TLVVGASYVGLECAGFLAGLGLDVTVMVRSVLLRGFDQEMAEKVGSYLEQQGVKFQRKFT
PILVQQLEKGLPGKLKVV

Pyr_redox

Pyr_redox
PFAM accession number:PF00070
Interpro abstract (IPR039648):

Proteins containing this domain include both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain [ (PUBMED:8805537) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pyr_redox