The domain within your query sequence starts at position 372 and ends at position 485; the E-value for the Pyr_redox_dim domain shown below is 2.8e-31.

IPTTVFTPLEYGCCGLSEEKAIEMYKKENLEVYHTLFWPLEWTVAGRDNNTCYAKIICNK
FDNERVVGFHLLGPNAGEITQGFAAAMKCGLTKQLLDDTIGIHPTCGEVFTTLE

Pyr_redox_dim

Pyr_redox_dim
PFAM accession number:PF02852
Interpro abstract (IPR004099):

This entry represents a dimerisation domain that is usually found at the C-terminal of both class I and class II oxidoreductases, as well as in NADH oxidases and peroxidases [ (PUBMED:7766608) (PUBMED:11090282) (PUBMED:12390015) ].

GO process:cell redox homeostasis (GO:0045454), oxidation-reduction process (GO:0055114)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Pyr_redox_dim