The domain within your query sequence starts at position 53 and ends at position 338; the E-value for the Q_salvage domain shown below is 9.7e-122.
LNPRGADEAALGWVFLVDSLNFSFWAEREDSKCAVRYGGTPYTGYWALCAAVNRALDQGI PITSASYYATVSLEQVRDIFRSDTAVPMPLMEERHRILNETGKILLEKFGGSFLNCVQKS GRSAQKLMQLIVENFPSYRDEAEFEGKRIAFYKRAQILVADTWSVLEGKGDGCFEDISSI TMFADYRLPQILVYLGALKYSDELLKKLLKGEMLLNGDKQEVEIRGCSIWCVELIRDRLL ELLEKGENSPVEINSVLLDYHLWDYAREHREDMKGVPFHRTRCIYY
Q_salvage |
![]() |
---|
PFAM accession number: | PF10343 |
---|---|
Interpro abstract (IPR019438): | Queuosine salvage proteins occur in most Eukarya as well as in a few bacteria possible via horizontal gene-transfer. Queuosine (Q) is a chemical modification found at the wobble position of tRNAs that have GUN anticodons. Most bacteria synthesize queuosine de novo, whereas eukaryotes rely solely on salvaging this essential component from the environment or the gut flora. The exact enzymatic function of the domain has yet to be determined, but structural similarity with DNA glycosidases suggests a ribonucleoside hydrolase role [ (PUBMED:24911101) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Q_salvage