The domain within your query sequence starts at position 238 and ends at position 353; the E-value for the QueC domain shown below is 5.3e-9.
KVLVLLSGGVDSTVCTALLNRALNQDQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVI NAAHSFYNGTTTLPISDEDRTPRKRISKTLNMTTSPEEKRKIIGDTFVKIANEVIG
QueC |
 |
|---|
| PFAM accession number: | PF06508 |
|---|---|
| Interpro abstract (IPR018317): | Queuosine biosynthesis protein (QueC), also known as 7-cyano-7-deazaguanine synthase, catalyzes the ATP-dependent conversion of 7-carboxy-7-deazaguanine (CDG) to 7-cyano-7-deazaguanine (preQ0) [ (PUBMED:16199558) (PUBMED:19354300) (PUBMED:18491386) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry QueC