The domain within your query sequence starts at position 43 and ends at position 177; the E-value for the R3H-assoc domain shown below is 1.2e-35.
RKQHFINQAVRNSDLVPRAKGRKSLQRLENTQYLLTLLETAGGPPGVEDGDLTPAAPGIF AEACSNATYVEVWNDFMNRSGEEQERVLRYLEDESQGKRRRGPGRGEDRRREDPVFTPHE CFRRISRRLRSVLKR
R3H-assoc |
![]() |
---|
PFAM accession number: | PF13902 |
---|---|
Interpro abstract (IPR025952): | This domain is sometimes found towards the N terminus of R3H domain-containing proteins. Its function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry R3H-assoc