The domain within your query sequence starts at position 937 and ends at position 975; the E-value for the RAD51_interact domain shown below is 1.3e-20.
GGSHFSHGISRVQPLKTCSRPIRVGLSRRARLKQLHPYL
RAD51_interact |
![]() |
---|
PFAM accession number: | PF15696 |
---|---|
Interpro abstract (IPR031419): | This motif interacts with RAD51, a protein that plays an important role in mitotic and meiotic recombination, and in DNA repair [ (PUBMED:16990250) ]. This motif is found C-terminal in RAD51-associated protein 1 (RAD51AP1) and 2 (RAD51AP2). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAD51_interact