The domain within your query sequence starts at position 96 and ends at position 259; the E-value for the RAI16-like domain shown below is 7.2e-42.

LLEFALREDLLSRVLTWQLQWDEFGDGVEERRAEQLKLFEMLVSEARQPLLRHGPVREAL
LALLDACGRPVPSSPALDEGLVLLLSQLCVCVAREPSLLEFFLQPPPEPGAAPRLLLFSR
LVPFVHREGTLGQQARDALLLLMALSDGSPTVGRYIADHSYFCP

RAI16-like

• PFAM accession number: PF10257
• Interpro abstract (IPR019384):

  This entry represents a conserved sequence region found in a family of proteins described as retinoic acid-induced protein 16-like proteins. These proteins are conserved from worms to humans, but their function is not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RAI16-like