The domain within your query sequence starts at position 166 and ends at position 264; the E-value for the RBB1NT domain shown below is 3.4e-46.
RKQTDELLGKVVCVDYVSLEKKKAMWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSV PRKDVHEITSDTVPKPDAVLKQAFDQALEFHKSRAIPAN
RBB1NT |
---|
PFAM accession number: | PF08169 |
---|---|
Interpro abstract (IPR012603): | This domain is found N-terminal to the ARID/BRIGHT domain in DNA-binding proteins of the Retinoblastoma-binding protein 1 family [ (PUBMED:15112237) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RBB1NT