The domain within your query sequence starts at position 229 and ends at position 389; the E-value for the RDD domain shown below is 2.9e-13.
IPSLAHRFMAEMVDFFILFFIKATIVLSIMHLSGIKDISKFAMHYIIEEIDEDTSMEDLQ KMMIVALIYRLLVCFYEIICIWGAGGATPGKFLLGLRVVTCDTSVLIAPSRVLVIPSSNV SITTSTIRALIKNFSIASFFPAFITLLFFQHNRTAYDIVAG
RDD |
---|
PFAM accession number: | PF06271 |
---|---|
Interpro abstract (IPR010432): | This domain contains three highly conserved amino acids: one arginine and two aspartates, hence the name of RDD domain. This region contains two predicted transmembrane regions. The arginine occurs at the N terminus of the first helix and the first aspartate occurs in the middle of this helix. In Halobacillus andaensis, RDD has been shown to function as a Na+(Li+, K+)/H+ antiporter [ (PUBMED:29922240) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RDD