The domain within your query sequence starts at position 1 and ends at position 233; the E-value for the RHINO domain shown below is 1.4e-107.

MPPKKRRRQSQKAQLLFHQQPLEGPKHHYESCQQPITHTVQVPSKPIDQSTVTSWVSPQF
DRAAESRFLIHRKPHRDQARRPTRRSTCKFPRLTFESPQSSSSETLLLSNRVQPQNSEKD
PPRRPLVPLFSPQSCGELSVHVPHSLPHVFAPPDIQTPDSSVRDDPISPDQKENSFPSCI
LGPGTPSSPEPGPVLVKDTPEEKYGIKVTWRRRRHLFAYLKEKGKLDGSQFLV

RHINO

RHINO
PFAM accession number:PF15319
Interpro abstract (IPR029293):

This entry represents Rad9, Rad1, Hus1-interacting nuclear orphan protein 1 (RHINO or RHNO1), which plays a role in DNA damage response (DDR) signalling upon genotoxic stresses such as ionizing radiation (IR) during the S phase [ (PUBMED:21659603) ]. RHNO1 is recruited to sites of DNA damage through interaction with the Rad9-Rad1-Hus1 (9-1-1) complex and ATR activator TopBP1. It plays a role in ATR-mediated activation of Chk1 driven by TopBP1 and 9-1-1 [ (PUBMED:21659603) ]. It is involved in mammary carcinogenesis [ (PUBMED:20811708) ].

GO process:DNA damage checkpoint (GO:0000077), cellular response to ionizing radiation (GO:0071479)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RHINO