The domain within your query sequence starts at position 223 and ends at position 281; the E-value for the RILP domain shown below is 1.1e-21.
SREELKQILQERNELKANVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVKKQRRKIK
RILP |
![]() |
---|
PFAM accession number: | PF11461 |
---|---|
Interpro abstract (IPR021563): | Rab interacting lysosomal protein (RILP) contains a domain which contains two coiled-coil regions and is found mainly in the cytosol. RILP is recruited onto late endosomal and lysosomal membranes by Rab7 and acts as a downstream effector of Rab7 [ (PUBMED:15933719) ]. This recruitment process is important for phagosome maturation and fusion with late endosomes and lysosomes. |
GO function: | protein dimerization activity (GO:0046983) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RILP