SMART: Pfam domain RLL

The domain within your query sequence starts at position 2 and ends at position 244; the E-value for the RLL domain shown below is 2.6e-92.

FRRKLTALDYHNPSGFKCKDETEFRNFNVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFE
KYLKDVNCPFKIQDQQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNRKNTDNAAKNAEPLI
NLDVNNPDFKAGVMALANLLQIQHHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPV
ALGKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGK
VGR

RLL

PFAM accession number:	PF10036
Interpro abstract (IPR019265):	This entry represents RNA transcription, translation and transport factor protein (RTRAF, also known as hCLE/C14orf166) from eukaryotes. It is part of the DDX1-HSPC117-FAM98B complex that shuttles between the nucleus and the cytoplasm transporting RNAs [ (PUBMED:24608264) ]. It is also a component of the tRNA-splicing ligase complex and is required for tRNA ligation [ (PUBMED:24870230) ]. Human RTRAF works as a positive modulator of the RNA polymerase II activity [ (PUBMED:16950395) ]. It also interacts with influenza virus polymerase subunit PA and plays an important role in influenza virus replication [ (PUBMED:21900157) ].

PFAM accession number:

PF10036

Interpro abstract (IPR019265):

This entry represents RNA transcription, translation and transport factor protein (RTRAF, also known as hCLE/C14orf166) from eukaryotes. It is part of the DDX1-HSPC117-FAM98B complex that shuttles between the nucleus and the cytoplasm transporting RNAs [ (PUBMED:24608264) ]. It is also a component of the tRNA-splicing ligase complex and is required for tRNA ligation [ (PUBMED:24870230) ]. Human RTRAF works as a positive modulator of the RNA polymerase II activity [ (PUBMED:16950395) ]. It also interacts with influenza virus polymerase subunit PA and plays an important role in influenza virus replication [ (PUBMED:21900157) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry RLL