The domain within your query sequence starts at position 49 and ends at position 385; the E-value for the RNA_pol_I_A49 domain shown below is 4.1e-105.
QNPGDMRFTLYNSTDLVNPRQRSHRIVAAETDRLSYVGNNFGTGALKCNALCRHFVGILN KTSGQMEVYDAELFNMQPLFADDAIEREPPLENQNKTFRDKLDSCIEAFGSTKQKRSLNS RRMNKVGSESLNLSVAKAAESIIDTKGVNALVSDAMQDDLQDGVLYLPPCYADAAKPEDV YRFEDILSPAEYDALESPSEAFRKVTSEDILKMIEENSHCSYVIEMLKSLPIDEVHRNRQ ARSIWFLDALIRFRAQKVIKGKRALGPGIPHIINTKLLKQFTCLTYNNGRLQNLISSSMR AKITSYAIILALHINNFQVDLTALQKDLKLSEKRPST
RNA_pol_I_A49 |
---|
PFAM accession number: | PF06870 |
---|---|
Interpro abstract (IPR009668): | Saccharomyces cerevisiae A49 is a specific subunit associated with RNA polymerase I (Pol I) in eukaryotes. Pol I maintains transcription activities in A49 deletion mutants. However, such mutants are deficient in transcription activity at low temperatures. Deletion analysis of the fusion yeast homologue indicates that only the C-terminal two thirds are required for function. Transcript analysis has demonstrated that A49 is maximising transcription of ribosomal DNA [ (PUBMED:12893961) ]. |
GO process: | transcription, DNA-templated (GO:0006351) |
GO function: | DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_I_A49