The domain within your query sequence starts at position 79 and ends at position 201; the E-value for the RNA_pol_Rbc25 domain shown below is 2.4e-46.
PFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAH DLYMDTGEEIRFRVVDESFVDTSPTGPSSAEAASSSEELPKKEAPYTLVGSISEPGLGLL SWW
RNA_pol_Rbc25 |
---|
PFAM accession number: | PF08292 |
---|---|
Interpro abstract (IPR013238): | Rpc25 is a strongly conserved subunit of RNA polymerase III and has homology to Rpa43 in RNA polymerase I, Rpb7 in RNA polymerase II and the archaeal RpoE subunit. Rpc25 is required for transcription initiation and is not essential for the elongating properties of RNA polymerase III [ (PUBMED:15612920) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry RNA_pol_Rbc25